PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000157G0800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 218aa    MW: 23218.9 Da    PI: 6.5241
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000157G0800genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.3e-19129162134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C + +Tp+WR gpdg++tLCnaCG+++++ +
  PH01000157G0800 129 CTHCAVEETPQWRLGPDGPRTLCNACGVRFKSGR 162
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-15123173IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.556123159IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15125186No hitNo description
Gene3DG3DSA:3.30.50.104.3E-14127160IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.01E-15128177No hitNo description
PROSITE patternPS003440129154IPR000679Zinc finger, GATA-type
PfamPF003203.2E-17129162IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MVGGGAADKD AAAQAEELPS GAGASLIGFF DHTVAVSPMT VAEGLEVAAG GEGQGEGEEE  60
EELEWLLNKD AFPSVETMAA EVEAAPARAA VGPRTKGLRR RRRVTAPWSL PPVLPSPPQA  120
AAGAPRRRCT HCAVEETPQW RLGPDGPRTL CNACGVRFKS GRLFPEYRPA NSPTFSPLLH  180
SNSHRRVQEM RRQSEDETSA ADRASAKARR AERAEDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1197961e-110AC119796.2 Oryza sativa Japonica Group chromosome 3 clone OJ1172F09, complete sequence.
GenBankAP0149591e-110AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629220.12e-75PREDICTED: GATA transcription factor 3
SwissprotQ8L4M67e-35GATA3_ARATH; GATA transcription factor 3
TrEMBLA0A0E0CV612e-84A0A0E0CV61_9ORYZ; Uncharacterized protein
STRINGORGLA03G0032900.15e-76(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.13e-33GATA transcription factor 1